DuPont WFROM1000X Quick Twist Membranfiltreringspatron för omvänd osmos, 1 antal (förpackning med 1), vit

Brand:DuPont

3.8/5

1432.95

PRODUKTBESKRIVNING QuickTwist Undersink Cartridge för omvänd osmos är certifierad för att reducera 90 % av det totala antalet lösta fasta partiklar. Minskar bly & femvärdig arsenik. Håller upp till 12 månader. FRÅN TILLVERKAREN Avancerade vattenfilter under diskbänken hjälper till att göra dricksvatten säkrare för din familj. Med förbättrad smak och större klarhet hittar du bättre smak i mat och dryck när de är gjorda med filtrerat vatten. Våra Quick Twist-vattenfilter är fristående, patentskyddade system. De är designade för att endast passa DuPont Quick Twist-filterpatroner och garanterar enkelt byte av patron utan spill. Många av våra andra filter och system är universella och är designade för att passa de flesta andra märken av vattenfilter under diskhon.

Inga enheter tillgängliga
Håller upp till 12 månader. 1/4 varvs snabbväxlingssystem möjliggör byte utan stök. QuickTwist bytessystem med automatisk avstängning för enkelt byte. Vattenfiltreringsmembranet för omvänd osmos är certifierat för att minska 90 % av totala lösta fasta ämnen, bly och femvärdig arsenik. Passar DuPont 3-stegs omvänd osmos dricksvattenfiltreringssystem.
Assembled Diameter ‎2.25 Inches
Batteries Included? ‎No
Batteries Required? ‎No
Color ‎White
Customer Reviews 4.7 4.7 out of 5 stars 262 ratings 4.7 out of 5 stars
Cutting Diameter ‎2.25 Inches
Finish ‎No Finish
Included Components ‎Reverse Osmosis Membrane Filtration Quick Twist Cartridge
Is Discontinued By Manufacturer ‎No
Item model number ‎WFROM1000X
Item Package Quantity ‎1
Item Weight ‎14.1 ounces
Manufacturer ‎DTP Vendor A3RBLNEOZFTF6F
Material ‎Plastic; Carbon; KDF
Number Of Pieces ‎1
Part Number ‎WFROM1000X
Size ‎1 Count
Usage ‎Indoor use only

3.8

10 Review
5 Star
80
4 Star
15
3 Star
2
2 Star
2
1 Star
2

Skriv din recension

Din e-post kommer inte att publiceras. Alla obligatoriska fält är markerade med*

Scritto da: TTTKKY6647
Perfect replacement for osmosis system
Easy to install, but first I confused to install it but I figured out easily
Scritto da: Don
As described
Easy to us
Scritto da: T. McCool
Cost to replace three filters is more than what I paid for the sytem
The cost of this filter plus the other two that you must buy to replace all three filters cost more than what I paid for the entire drinking water system. However, the flavor of the water from the system is good and installation is easy. This is the third different brand of drinking water system I have owned and the DuPont system is the easiest to switch out the filters. No special tools required. However, the water tank loses air pressure and I have to use a bicycle pump to get the pressure back up, about once a year. I never had to do that with previous systems. I will probably replace the entire system when the life of the filters expires, and will not buy the same.
Scritto da: JaBlvn
fits and works fine
as advertised
Scritto da: robert belair
Less expensive , easier to find than a store
These filters are easy to install and less expensive than at stores. Also they are hard to find in stores.
Scritto da: Maurizio
DuPont good brand
High price, but no better choose, very simple to install.
Scritto da: angel lutt
easy to install
nothing
Scritto da: JC in MN
Works as designed.
Product fits, doesn't leak, and performs as designed. There is a carbon block before and after this RO filter and though I have not tested TDS, this system makes great tasting water. It removes all odors, such as chlorine. I have city water which has significant amounts of iron and other soluables to a total of about 250 ppm of TDS. The water treated with this filter leaves no residue when evaporated in or on glass so that would suggest a high rejection rate. I believe I read about 90% rejection rate in the instruction manual which is certainly sufficient for drinking and cooking water.
Scritto da: Linda Nicholls
Quick delivery
Delivered quickly and product just as pictured
Scritto da: David Siemens
Works
Easy to install

Relaterade produkter

hot
Everpure Cc1E Cc3E Cartridge Kit
3.1/5

€ 14803.64

Everpure Cc1E Cc3E Cartridge Kit
3.1/5

€ 14803.64

Upptäck vårt internationella nätverk

Vi skickar till 28 länder, över 200 000 produkter. Håll dig uppdaterad, prenumerera på nyhetsbrevet.

Array